Lineage for d1jk0b_ (1jk0 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990178Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1990185Species Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId:4932] [88796] (2 PDB entries)
    Uniprot P49723
  8. 1990186Domain d1jk0b_: 1jk0 B: [63143]
    heterodimer with Y2 isoform
    complexed with zn

Details for d1jk0b_

PDB Entry: 1jk0 (more details), 2.8 Å

PDB Description: Ribonucleotide reductase Y2Y4 heterodimer
PDB Compounds: (B:) ribonucleoside-diphosphate reductase small chain 2

SCOPe Domain Sequences for d1jk0b_:

Sequence, based on SEQRES records: (download)

>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]}
fqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeeielakdted
fqkltddqktyignllalsissdnlvnkylienfsaqlqnpegksfygfqimmeniysev
ysmmvdaffkdpkniplfkeianlpevkhkaafierwisnddslyaerlvafaakegifq
agnyasmfwltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpkiiekiitea
veiekeyysnslpvekfgmdlksihtyiefvadgllqgfgnekyy

Sequence, based on observed residues (ATOM records): (download)

>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]}
fqkerhdmkeaekdeillmensrrfvmfpikyheiwaaykkveasfwtaeeielakdted
fqkltddqktyignllalsilienfsaqlqnpegksfygfqimmeniysevysmmvdaff
kdpkniplfkeianlpevkhkaafierwisnddslyaerlvafaakegifqagnyasmfw
ltdkkimpglamanrnicrdrgaytdfscllfahlrtkpnpkiiekiiteaveiekeyys
nslphtyiefvadgllqgfgnekyy

SCOPe Domain Coordinates for d1jk0b_:

Click to download the PDB-style file with coordinates for d1jk0b_.
(The format of our PDB-style files is described here.)

Timeline for d1jk0b_: