SCOP 1.71: Domain d1jk0a_: 1jk0 A:

Lineage for d1jk0a_ (1jk0 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId:4932] [88795] (2 PDB entries)

8. Domain d1jk0a_: 1jk0 A: [63142]
   heterodimer with Y4 isoform
   complexed with zn

Details for d1jk0a_

PDB Entry: 1jk0, 2.8 Å

PDB Description: Ribonucleotide reductase Y2Y4 heterodimer

SCOP Domain Sequences for d1jk0a_:

Sequence; same for both SEQRES and ATOM records:

>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasd
givnenlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaih
tipeigekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfs
nelicrdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnad
lmnqyvefvadrllvafgnkkyykvenpfdfmen

Timeline for d1jk0a_:

• d1jk0a_ first appeared in SCOP 1.57
  
• d1jk0a_ appears in SCOP 1.69
  
• d1jk0a_ appears in SCOP 1.73
  
• d1jk0a_ appears in the current release, SCOPe 2.08