Lineage for d1jjko_ (1jjk O:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814479Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 814526Species Escherichia coli [TaxId:562] [51378] (3 PDB entries)
  8. 814547Domain d1jjko_: 1jjk O: [63136]

Details for d1jjko_

PDB Entry: 1jjk (more details), 3 Å

PDB Description: selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group
PDB Compounds: (O:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d1jjko_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjko_ c.1.2.3 (O:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]}
vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq

SCOP Domain Coordinates for d1jjko_:

Click to download the PDB-style file with coordinates for d1jjko_.
(The format of our PDB-style files is described here.)

Timeline for d1jjko_: