| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
| Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
| Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
| Species Escherichia coli [TaxId:562] [51378] (3 PDB entries) |
| Domain d1jjkm_: 1jjk M: [63134] complexed with bmp |
PDB Entry: 1jjk (more details), 3 Å
SCOPe Domain Sequences for d1jjkm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjkm_ c.1.2.3 (M:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]}
vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
Timeline for d1jjkm_: