Lineage for d1jjkl_ (1jjk L:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172830Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 172837Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 172880Species Escherichia coli [TaxId:562] [51378] (3 PDB entries)
  8. 172898Domain d1jjkl_: 1jjk L: [63133]

Details for d1jjkl_

PDB Entry: 1jjk (more details), 3 Å

PDB Description: selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group

SCOP Domain Sequences for d1jjkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjkl_ c.1.2.3 (L:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli}
vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq

SCOP Domain Coordinates for d1jjkl_:

Click to download the PDB-style file with coordinates for d1jjkl_.
(The format of our PDB-style files is described here.)

Timeline for d1jjkl_: