Lineage for d1jjkb_ (1jjk B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64418Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 64433Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 64434Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 64454Species Escherichia coli [TaxId:562] [51378] (2 PDB entries)
  8. 64460Domain d1jjkb_: 1jjk B: [63123]

Details for d1jjkb_

PDB Entry: 1jjk (more details), 3 Å

PDB Description: selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group

SCOP Domain Sequences for d1jjkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjkb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli}
vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq

SCOP Domain Coordinates for d1jjkb_:

Click to download the PDB-style file with coordinates for d1jjkb_.
(The format of our PDB-style files is described here.)

Timeline for d1jjkb_: