SCOP 1.75: Domain d1jjeb_: 1jje B:

Lineage for d1jjeb_ (1jje B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (10 species)

7. Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (6 PDB entries)

8. Domain d1jjeb_: 1jje B: [63118]
   complexed with act, bys, zn

Details for d1jjeb_

PDB Entry: 1jje, 1.8 Å

PDB Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (11)

PDB Compounds: (B:) imp-1 metallo beta-lactamase

SCOP Domain Sequences for d1jjeb_:

Sequence; same for both SEQRES and ATOM records:

>d1jjeb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
kllkskygkaklvvpshsevgdasllkltleqavkglnesk

Timeline for d1jjeb_:

• d1jjeb_ first appeared in SCOP 1.57
  
• d1jjeb_ appears in SCOP 1.73
  
• d1jjeb_ appears in SCOPe 2.01
  
• d1jjeb_ appears in the current release, SCOPe 2.08