Lineage for d1jj9a_ (1jj9 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135817Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)
  6. 135866Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 135867Species Human (Homo sapiens) [TaxId:9606] [55533] (14 PDB entries)
  8. 135876Domain d1jj9a_: 1jj9 A: [63115]

Details for d1jj9a_

PDB Entry: 1jj9 (more details), 2 Å

PDB Description: crystal structure of mmp8-barbiturate complex reveals mechanism for collagen substrate recognition

SCOP Domain Sequences for d1jj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj9a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOP Domain Coordinates for d1jj9a_:

Click to download the PDB-style file with coordinates for d1jj9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jj9a_: