SCOPe 2.03: Domain d1jj4a_: 1jj4 A:

Lineage for d1jj4a_ (1jj4 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries)

8. Domain d1jj4a_: 1jj4 A: [63112]
   protein/DNA complex

Details for d1jj4a_

PDB Entry: 1jj4, 2.4 Å

PDB Description: human papillomavirus type 18 e2 dna-binding domain bound to its dna target

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1jj4a_:

Sequence, based on SEQRES records:

>d1jj4a_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
mtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrtk
flntvaipdsvqilvgymt

Sequence, based on observed residues (ATOM records):

>d1jj4a_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
mtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtktgiltvtyhsetqrtkflntv
aipdsvqilvgymt

Timeline for d1jj4a_:

• d1jj4a_ first appeared in SCOP 1.57
  
• d1jj4a_ appears in SCOPe 2.02
  
• d1jj4a_ appears in SCOPe 2.04
  
• d1jj4a_ appears in the current release, SCOPe 2.08, called d1jj4a1