Lineage for d1jj2z_ (1jj2 Z:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966433Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1966495Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 1966496Protein Ribosomal protein L37e [57834] (1 species)
  7. 1966497Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 1966504Domain d1jj2z_: 1jj2 Z: [63111]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_
    complexed with cd, cl, k, mg, na

Details for d1jj2z_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
PDB Compounds: (Z:) ribosomal protein l37e

SCOPe Domain Sequences for d1jj2z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2z_ g.41.8.2 (Z:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1jj2z_:

Click to download the PDB-style file with coordinates for d1jj2z_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2z_: