Lineage for d1jj2w_ (1jj2 W:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410314Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 410315Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 410316Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 410317Protein Ribosomal protein L31e [54577] (1 species)
  7. 410318Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (18 PDB entries)
  8. 410319Domain d1jj2w_: 1jj2 W: [63108]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2w_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2w_ d.29.1.1 (W:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1jj2w_:

Click to download the PDB-style file with coordinates for d1jj2w_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2w_: