Lineage for d1jj2v_ (1jj2 V:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413453Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 413454Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 413455Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 413456Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 413457Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (18 PDB entries)
  8. 413458Domain d1jj2v_: 1jj2 V: [63107]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2v_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2v_ d.59.1.1 (V:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1jj2v_:

Click to download the PDB-style file with coordinates for d1jj2v_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2v_: