SCOP 1.73: Domain d1jj2u_: 1jj2 U:

Lineage for d1jj2u_ (1jj2 U:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)

8. Domain d1jj2u_: 1jj2 U: [63106]
   Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
   complexed with cd, cl, k, mg, na

Details for d1jj2u_

PDB Entry: 1jj2, 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

PDB Compounds: (U:) ribosomal protein l29

SCOP Domain Sequences for d1jj2u_:

Sequence; same for both SEQRES and ATOM records:

>d1jj2u_ a.2.2.1 (U:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1jj2u_:

• d1jj2u_ first appeared in SCOP 1.57
  
• d1jj2u_ appears in SCOP 1.71
  
• d1jj2u_ appears in SCOP 1.75
  
• d1jj2u_ appears in the current release, SCOPe 2.08