Lineage for d1jj2u_ (1jj2 U:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276876Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 276877Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 276878Protein Ribosomal protein L29 (L29p) [46563] (1 species)
  7. 276879Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (12 PDB entries)
  8. 276880Domain d1jj2u_: 1jj2 U: [63106]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2u_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2u_ a.2.2.1 (U:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1jj2u_:

Click to download the PDB-style file with coordinates for d1jj2u_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2u_: