Lineage for d1jj2t_ (1jj2 T:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144739Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 144740Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 144834Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 144835Protein Ribosomal protein L24e [57750] (1 species)
  7. 144836Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (3 PDB entries)
  8. 144837Domain d1jj2t_: 1jj2 T: [63105]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2t_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2t_ g.39.1.6 (T:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1jj2t_:

Click to download the PDB-style file with coordinates for d1jj2t_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2t_: