Lineage for d1jj2r_ (1jj2 R:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325126Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 325127Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 325128Family d.12.1.1: L23p [54190] (1 protein)
  6. 325129Protein Ribosomal protein L23 [54191] (2 species)
  7. 325130Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (12 PDB entries)
  8. 325131Domain d1jj2r_: 1jj2 R: [63103]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2r_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2r_ d.12.1.1 (R:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1jj2r_:

Click to download the PDB-style file with coordinates for d1jj2r_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2r_: