Lineage for d1jj2q_ (1jj2 Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192326Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2192327Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2192328Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2192329Protein Ribosomal protein L22 [54845] (5 species)
  7. 2192367Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2192374Domain d1jj2q_: 1jj2 Q: [63102]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2q_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
PDB Compounds: (Q:) ribosomal protein l22

SCOPe Domain Sequences for d1jj2q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2q_ d.55.1.1 (Q:) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d1jj2q_:

Click to download the PDB-style file with coordinates for d1jj2q_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2q_: