Lineage for d1jj2o_ (1jj2 O:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919879Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 919880Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 919881Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 919882Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 919883Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 919891Domain d1jj2o_: 1jj2 O: [63100]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2o_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
PDB Compounds: (O:) ribosomal protein l19e

SCOPe Domain Sequences for d1jj2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2o_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1jj2o_:

Click to download the PDB-style file with coordinates for d1jj2o_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2o_: