Lineage for d1jj2n_ (1jj2 N:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67840Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
  4. 67841Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 67842Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 67847Protein Ribosomal protein L18e [52084] (1 species)
  7. 67848Species Haloarcula marismortui [TaxId:2238] [52085] (2 PDB entries)
  8. 67849Domain d1jj2n_: 1jj2 N: [63099]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2n_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2n_ c.12.1.1 (N:) Ribosomal protein L18e {Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1jj2n_:

Click to download the PDB-style file with coordinates for d1jj2n_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2n_: