Lineage for d1jj2m_ (1jj2 M:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72254Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 72255Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 72256Protein Ribosomal protein L18 (L18p) [53139] (1 species)
  7. 72257Species Haloarcula marismortui [TaxId:2238] [53140] (2 PDB entries)
  8. 72258Domain d1jj2m_: 1jj2 M: [63098]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2m_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2m_ c.55.4.1 (M:) Ribosomal protein L18 (L18p) {Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1jj2m_:

Click to download the PDB-style file with coordinates for d1jj2m_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2m_: