Lineage for d1jj2j_ (1jj2 J:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296781Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 296782Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 296783Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 296784Protein Ribosomal protein L14 [50195] (2 species)
  7. 296785Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (12 PDB entries)
  8. 296786Domain d1jj2j_: 1jj2 J: [63095]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2j_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2j_ b.39.1.1 (J:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1jj2j_:

Click to download the PDB-style file with coordinates for d1jj2j_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2j_: