Lineage for d1jj2i_ (1jj2 I:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120190Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
  4. 120191Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 120192Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 120193Protein Ribosomal protein L13 [52163] (1 species)
  7. 120194Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (3 PDB entries)
  8. 120195Domain d1jj2i_: 1jj2 I: [63094]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2i_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2i_ c.21.1.1 (I:) Ribosomal protein L13 {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1jj2i_:

Click to download the PDB-style file with coordinates for d1jj2i_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2i_: