SCOP 1.61: Domain d1jj2g_: 1jj2 G:

Lineage for d1jj2g_ (1jj2 G:)

1. Root: SCOP 1.61

2. Class j: Peptides [58231] (95 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (6 PDB entries)

8. Domain d1jj2g_: 1jj2 G: [63092]
   Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2g_

PDB Entry: 1jj2, 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2g_:

Sequence, based on SEQRES records:

>d1jj2g_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1jj2g_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1jj2g_:

• d1jj2g_ first appeared in SCOP 1.57
  
• d1jj2g_ appears in SCOP 1.59
  
• d1jj2g_ appears in SCOP 1.63
  
• d1jj2g_ appears in the current release, SCOPe 2.08