| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) |
Superfamily d.79.3: L30e-like [55315] (3 families) ![]() |
| Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
| Protein Ribosomal protein L7ae [55319] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (7 PDB entries) |
| Domain d1jj2f_: 1jj2 F: [63091] Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOP Domain Sequences for d1jj2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj2f_ d.79.3.1 (F:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
Timeline for d1jj2f_:
View in 3DDomains from other chains: (mouse over for more information) d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |