Lineage for d1jj2f_ (1jj2 F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81402Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)
  4. 81482Superfamily d.79.3: L30e-like [55315] (2 families) (S)
  5. 81483Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 81493Protein Ribosomal protein L7ae [55319] (1 species)
  7. 81494Species Haloarcula marismortui [TaxId:2238] [55320] (2 PDB entries)
  8. 81495Domain d1jj2f_: 1jj2 F: [63091]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2f_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2f_ d.79.3.1 (F:) Ribosomal protein L7ae {Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1jj2f_:

Click to download the PDB-style file with coordinates for d1jj2f_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2f_: