Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
Domain d1jj2e2: 1jj2 E:80-172 [63090] Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d1jj2e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj2e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]} weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie avgqtaadieqltrindkdvrvfqdgvyitrkp
Timeline for d1jj2e2:
View in 3D Domains from other chains: (mouse over for more information) d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |