Lineage for d1jj2e1 (1jj2 E:1-79)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334675Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 334676Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 334677Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 334678Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 334679Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (12 PDB entries)
  8. 334680Domain d1jj2e1: 1jj2 E:1-79 [63089]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2e1

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2e1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1jj2e1:

Click to download the PDB-style file with coordinates for d1jj2e1.
(The format of our PDB-style files is described here.)

Timeline for d1jj2e1: