Lineage for d1jj2d_ (1jj2 D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81370Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
  4. 81371Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 81372Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 81373Protein Ribosomal protein L5 [55284] (2 species)
  7. 81377Species Haloarcula marismortui [TaxId:2238] [55285] (2 PDB entries)
  8. 81378Domain d1jj2d_: 1jj2 D: [63088]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj2d_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2d_:

Sequence, based on SEQRES records: (download)

>d1jj2d_ d.77.1.1 (D:) Ribosomal protein L5 {Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1jj2d_ d.77.1.1 (D:) Ribosomal protein L5 {Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1jj2d_:

Click to download the PDB-style file with coordinates for d1jj2d_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2d_: