Lineage for d1jj2a2 (1jj2 A:1-90)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 297648Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    lacks the last strand
  7. 297649Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (12 PDB entries)
    includes the N-terminal tail
  8. 297650Domain d1jj2a2: 1jj2 A:1-90 [63085]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2a2

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOP Domain Coordinates for d1jj2a2:

Click to download the PDB-style file with coordinates for d1jj2a2.
(The format of our PDB-style files is described here.)

Timeline for d1jj2a2: