| Class b: All beta proteins [48724] (104 folds) |
| Fold b.40: OB-fold [50198] (7 superfamilies) |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins) |
| Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) |
| Species Haloarcula marismortui [TaxId:2238] [50301] (2 PDB entries) |
| Domain d1jj2a2: 1jj2 A:1-90 [63085] Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOP Domain Sequences for d1jj2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj2a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap
Timeline for d1jj2a2:
View in 3DDomains from other chains: (mouse over for more information) d1jj21_, d1jj22_, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |