![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (10 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (3 families) ![]() |
![]() | Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein) |
![]() | Protein Ribosomal protein L44e [57837] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (8 PDB entries) |
![]() | Domain d1jj22_: 1jj2 2: [63083] Other proteins in same PDB: d1jj21_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOP Domain Sequences for d1jj22_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj22_ g.41.8.3 (2:) Ribosomal protein L44e {Archaeon Haloarcula marismortui} mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d1jj22_:
![]() Domains from other chains: (mouse over for more information) d1jj21_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |