Lineage for d1jj22_ (1jj2 2:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271530Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (3 families) (S)
  5. 271553Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 271554Protein Ribosomal protein L44e [57837] (1 species)
  7. 271555Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (8 PDB entries)
  8. 271556Domain d1jj22_: 1jj2 2: [63083]
    Other proteins in same PDB: d1jj21_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj22_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj22_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj22_ g.41.8.3 (2:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1jj22_:

Click to download the PDB-style file with coordinates for d1jj22_.
(The format of our PDB-style files is described here.)

Timeline for d1jj22_: