![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix |
![]() | Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
![]() | Protein Ribosomal protein L39e [48664] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
![]() | Domain d1jj21_: 1jj2 1: [63082] Other proteins in same PDB: d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d1jj21_:
Sequence, based on SEQRES records: (download)
>d1jj21_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
>d1jj21_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
Timeline for d1jj21_:
![]() Domains from other chains: (mouse over for more information) d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |