SCOP 1.61: Domain d1jj21_: 1jj2 1:

Lineage for d1jj21_ (1jj2 1:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (7 PDB entries)

8. Domain d1jj21_: 1jj2 1: [63082]
   Other proteins in same PDB: d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_

Details for d1jj21_

PDB Entry: 1jj2, 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

SCOP Domain Sequences for d1jj21_:

Sequence, based on SEQRES records:

>d1jj21_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1jj21_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1jj21_:

• d1jj21_ first appeared in SCOP 1.57
  
• d1jj21_ appears in SCOP 1.59
  
• d1jj21_ appears in SCOP 1.63
  
• d1jj21_ appears in the current release, SCOPe 2.08