SCOPe 2.07: Domain d1jiwp2: 1jiw P:1-246

Lineage for d1jiwp2 (1jiw P:1-246)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Pseudomonas aeruginosa [TaxId:287] [55510] (3 PDB entries)
   alkaline protease

8. Domain d1jiwp2: 1jiw P:1-246 [63080]
   Other proteins in same PDB: d1jiwi_, d1jiwp1
   complexed with ca, zn

Details for d1jiwp2

PDB Entry: 1jiw, 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

PDB Compounds: (P:) alkaline metalloproteinase

SCOPe Domain Sequences for d1jiwp2:

Sequence; same for both SEQRES and ATOM records:

>d1jiwp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

Timeline for d1jiwp2:

• d1jiwp2 first appeared in SCOP 1.57
  
• d1jiwp2 appears in SCOPe 2.06
  
• d1jiwp2 appears in the current release, SCOPe 2.08