SCOPe 2.07: Domain d1jiwp1: 1jiw P:247-470

Lineage for d1jiwp1 (1jiw P:247-470)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.7: beta-Roll [51120] (2 families)
   superhelix turns are made of two short strands each

5. Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
   duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
   this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain

6. Protein Metalloprotease [51122] (4 species)
   The catalytic N-terminal domain belong to the "zincin" superfamily

7. Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries)
   alkaline protease

8. Domain d1jiwp1: 1jiw P:247-470 [63079]
   Other proteins in same PDB: d1jiwi_, d1jiwp2
   complexed with ca, zn

Details for d1jiwp1

PDB Entry: 1jiw, 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

PDB Compounds: (P:) alkaline metalloproteinase

SCOPe Domain Sequences for d1jiwp1:

Sequence; same for both SEQRES and ATOM records:

>d1jiwp1 b.80.7.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

Timeline for d1jiwp1:

• d1jiwp1 first appeared in SCOP 1.57
  
• d1jiwp1 appears in SCOPe 2.06
  
• d1jiwp1 appears in the current release, SCOPe 2.08