Lineage for d1jiwp1 (1jiw P:247-470)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806195Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806455Superfamily b.80.7: beta-Roll [51120] (2 families) (S)
    superhelix turns are made of two short strands each
  5. 1806456Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
    duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns
    this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain
  6. 1806457Protein Metalloprotease [51122] (4 species)
    The catalytic N-terminal domain belong to the "zincin" superfamily
  7. 1806468Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries)
    alkaline protease
  8. 1806470Domain d1jiwp1: 1jiw P:247-470 [63079]
    Other proteins in same PDB: d1jiwi_, d1jiwp2
    complexed with ca, zn

Details for d1jiwp1

PDB Entry: 1jiw (more details), 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex
PDB Compounds: (P:) alkaline metalloproteinase

SCOPe Domain Sequences for d1jiwp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiwp1 b.80.7.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]}
ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln
ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq
lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk
agqailsydaaskagslaidfsgdahadfainligqatqadivv

SCOPe Domain Coordinates for d1jiwp1:

Click to download the PDB-style file with coordinates for d1jiwp1.
(The format of our PDB-style files is described here.)

Timeline for d1jiwp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jiwp2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jiwi_