Class b: All beta proteins [48724] (141 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.7: beta-Roll [51120] (1 family) superhelix turns are made of two short strands each |
Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain |
Protein Metalloprotease [51122] (4 species) The catalytic N-terminal domain belong to the "zincin" superfamily |
Species Pseudomonas aeruginosa [TaxId:287] [51123] (3 PDB entries) alkaline protease |
Domain d1jiwp1: 1jiw P:247-470 [63079] Other proteins in same PDB: d1jiwi_, d1jiwp2 complexed with ca, zn |
PDB Entry: 1jiw (more details), 1.74 Å
SCOP Domain Sequences for d1jiwp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiwp1 b.80.7.1 (P:247-470) Metalloprotease {Pseudomonas aeruginosa} ganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqnqkinln ekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilygglgadq lwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyvdafagk agqailsydaaskagslaidfsgdahadfainligqatqadivv
Timeline for d1jiwp1: