Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families) |
Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein) automatically mapped to Pfam PF02974 |
Protein Metalloprotease inhibitor [50884] (2 species) |
Species Pseudomonas aeruginosa, aprin [TaxId:287] [63813] (1 PDB entry) |
Domain d1jiwi_: 1jiw I: [63078] Other proteins in same PDB: d1jiwp1, d1jiwp2 complexed with ca, zn |
PDB Entry: 1jiw (more details), 1.74 Å
SCOPe Domain Sequences for d1jiwi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiwi_ b.61.2.1 (I:) Metalloprotease inhibitor {Pseudomonas aeruginosa, aprin [TaxId: 287]} sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrrat
Timeline for d1jiwi_: