Lineage for d1jiwi_ (1jiw I:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62326Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 62524Superfamily b.61.2: Metalloprotease inhibitor [50882] (1 family) (S)
  5. 62525Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein)
  6. 62526Protein Metalloprotease inhibitor [50884] (2 species)
  7. 62529Species Pseudomonas aeruginosa, aprin [TaxId:287] [63813] (1 PDB entry)
  8. 62530Domain d1jiwi_: 1jiw I: [63078]
    Other proteins in same PDB: d1jiwp1, d1jiwp2

Details for d1jiwi_

PDB Entry: 1jiw (more details), 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex

SCOP Domain Sequences for d1jiwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiwi_ b.61.2.1 (I:) Metalloprotease inhibitor {Pseudomonas aeruginosa, aprin}
sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra
wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrrat

SCOP Domain Coordinates for d1jiwi_:

Click to download the PDB-style file with coordinates for d1jiwi_.
(The format of our PDB-style files is described here.)

Timeline for d1jiwi_: