SCOP 1.75: Domain d1jibb3: 1jib B:121-502

Lineage for d1jibb3 (1jib B:121-502)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (16 PDB entries)

8. Domain d1jibb3: 1jib B:121-502 [63074]
   Other proteins in same PDB: d1jiba1, d1jiba2, d1jibb1, d1jibb2
   complexed with mtt; mutant

Details for d1jibb3

PDB Entry: 1jib, 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

PDB Compounds: (B:) neopullulanase

SCOP Domain Sequences for d1jibb3:

Sequence; same for both SEQRES and ATOM records:

>d1jibb3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

Timeline for d1jibb3:

• d1jibb3 first appeared in SCOP 1.57
  
• d1jibb3 appears in SCOP 1.73
  
• d1jibb3 appears in SCOPe 2.01
  
• d1jibb3 appears in the current release, SCOPe 2.08