Lineage for d1jibb3 (1jib B:121-502)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 proteins)
  6. 173367Protein Maltogenic amylase, central domain [51465] (4 species)
  7. 173374Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (7 PDB entries)
  8. 173388Domain d1jibb3: 1jib B:121-502 [63074]
    Other proteins in same PDB: d1jiba1, d1jiba2, d1jibb1, d1jibb2

Details for d1jibb3

PDB Entry: 1jib (more details), 3.3 Å

PDB Description: Complex of Alpha-amylase II (TVA II) from Thermoactinomyces vulgaris R-47 with Maltotetraose Based on a Crystal Soaked with Maltohexaose.

SCOP Domain Sequences for d1jibb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jibb3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOP Domain Coordinates for d1jibb3:

Click to download the PDB-style file with coordinates for d1jibb3.
(The format of our PDB-style files is described here.)

Timeline for d1jibb3: