SCOP 1.71: Domain d1jibb1: 1jib B:1-120

Lineage for d1jibb1 (1jib B:1-120)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)

8. Domain d1jibb1: 1jib B:1-120 [63072]
   Other proteins in same PDB: d1jiba2, d1jiba3, d1jibb2, d1jibb3
   complexed with mtt; mutant

Details for d1jibb1

PDB Entry: 1jib, 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

SCOP Domain Sequences for d1jibb1:

Sequence; same for both SEQRES and ATOM records:

>d1jibb1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1jibb1:

• d1jibb1 first appeared in SCOP 1.57
  
• d1jibb1 appears in SCOP 1.69
  
• d1jibb1 appears in SCOP 1.73
  
• d1jibb1 appears in the current release, SCOPe 2.08