Lineage for d1jiba2 (1jib A:503-585)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 171081Protein Maltogenic amylase [51031] (4 species)
  7. 171088Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries)
  8. 171101Domain d1jiba2: 1jib A:503-585 [63070]
    Other proteins in same PDB: d1jiba1, d1jiba3, d1jibb1, d1jibb3

Details for d1jiba2

PDB Entry: 1jib (more details), 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

SCOP Domain Sequences for d1jiba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiba2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1jiba2:

Click to download the PDB-style file with coordinates for d1jiba2.
(The format of our PDB-style files is described here.)

Timeline for d1jiba2: