Lineage for d1ji6a1 (1ji6 A:503-652)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774180Family b.18.1.3: delta-Endotoxin, C-terminal domain [49796] (1 protein)
    automatically mapped to Pfam PF03944
  6. 2774181Protein delta-Endotoxin, C-terminal domain [49797] (5 species)
  7. 2774186Species Bacillus thuringiensis, CRY3bb1 [TaxId:1428] [63716] (1 PDB entry)
  8. 2774187Domain d1ji6a1: 1ji6 A:503-652 [63066]
    Other proteins in same PDB: d1ji6a2, d1ji6a3

Details for d1ji6a1

PDB Entry: 1ji6 (more details), 2.4 Å

PDB Description: crystal structure of the insecticidal bacterial del endotoxin cry3bb1 bacillus thuringiensis
PDB Compounds: (A:) pesticidial crystal protein cry3bb

SCOPe Domain Sequences for d1ji6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji6a1 b.18.1.3 (A:503-652) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRY3bb1 [TaxId: 1428]}
ffntidaekitqlpvvkayalssgasiiegpgftggnllflkessnsiakfkvtlnsaal
lqryrvriryasttnlrlfvqnsnndflviyinktmnkdddltyqtfdlattnsnmgfsg
dkneliigaesfvsnekiyidkiefipvql

SCOPe Domain Coordinates for d1ji6a1:

Click to download the PDB-style file with coordinates for d1ji6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ji6a1: