SCOP 1.73: Domain d1jhta1: 1jht A:182-275

Lineage for d1jhta1 (1jht A:182-275)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d1jhta1: 1jht A:182-275 [63063]
   Other proteins in same PDB: d1jhta2, d1jhtb_
   mutant

Details for d1jhta1

PDB Entry: 1jht, 2.15 Å

PDB Description: crystal structure of hla-a2*0201 in complex with a nonameric altered peptide ligand (algigiltv) from the mart-1/melan-a.

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1jhta1:

Sequence, based on SEQRES records:

>d1jhta1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1jhta1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqttelvetrpagdgtfqk
waavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1jhta1:

• d1jhta1 first appeared in SCOP 1.57
  
• d1jhta1 appears in SCOP 1.71
  
• d1jhta1 appears in SCOP 1.75
  
• d1jhta1 appears in the current release, SCOPe 2.08