Lineage for d1jhhb1 (1jhh B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64088Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
  4. 64089Superfamily b.87.1: LexA/Signal peptidase [51306] (2 families) (S)
  5. 64090Family b.87.1.1: LexA-related [51307] (3 proteins)
  6. 64095Protein LexA C-terminal domain [63871] (1 species)
  7. 64096Species Escherichia coli [TaxId:562] [63872] (4 PDB entries)
  8. 64101Domain d1jhhb1: 1jhh B: [63062]
    Other proteins in same PDB: d1jhha1

Details for d1jhhb1

PDB Entry: 1jhh (more details), 2.1 Å

PDB Description: lexa s119a mutant

SCOP Domain Sequences for d1jhhb1:

Sequence, based on SEQRES records: (download)

>d1jhhb1 b.87.1.1 (B:) LexA C-terminal domain {Escherichia coli}
glplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmamkdigimdgdllavh
ktqdvrngqvvvariddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavg
virng

Sequence, based on observed residues (ATOM records): (download)

>d1jhhb1 b.87.1.1 (B:) LexA C-terminal domain {Escherichia coli}
glplvgrvaagepieghyqvdpslfkpnadfllrvsgmamkdigimdgdllavhktqdvr
ngqvvvariddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavgvirng

SCOP Domain Coordinates for d1jhhb1:

Click to download the PDB-style file with coordinates for d1jhhb1.
(The format of our PDB-style files is described here.)

Timeline for d1jhhb1: