SCOP 1.57: Domain d1jhha1: 1jhh A:2-72

Lineage for d1jhha1 (1jhh A:2-72)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.2: LexA repressor, N-terminal DNA-binding domain [46789] (1 protein)

6. Protein LexA repressor, N-terminal DNA-binding domain [46790] (1 species)

7. Species Escherichia coli [TaxId:562] [46791] (4 PDB entries)

8. Domain d1jhha1: 1jhh A:2-72 [63060]
   Other proteins in same PDB: d1jhha2, d1jhhb1

Details for d1jhha1

PDB Entry: 1jhh, 2.1 Å

PDB Description: lexa s119a mutant

SCOP Domain Sequences for d1jhha1:

Sequence; same for both SEQRES and ATOM records:

>d1jhha1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli}
kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
asrgirllqee

Timeline for d1jhha1:

• d1jhha1 is new in SCOP 1.57
  
• d1jhha1 appears in SCOP 1.59
  
• d1jhha1 appears in the current release, SCOPe 2.08