Lineage for d1jhfb_ (1jhf B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810080Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 1810081Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 1810082Family b.87.1.1: LexA-related [51307] (4 proteins)
  6. 1810095Protein LexA C-terminal domain [63871] (1 species)
  7. 1810096Species Escherichia coli [TaxId:562] [63872] (4 PDB entries)
  8. 1810098Domain d1jhfb_: 1jhf B: [63059]
    Other proteins in same PDB: d1jhfa1
    complexed with so4; mutant

Details for d1jhfb_

PDB Entry: 1jhf (more details), 1.8 Å

PDB Description: lexa g85d mutant
PDB Compounds: (B:) lexa repressor

SCOPe Domain Sequences for d1jhfb_:

Sequence, based on SEQRES records: (download)

>d1jhfb_ b.87.1.1 (B:) LexA C-terminal domain {Escherichia coli [TaxId: 562]}
glplvgrvaadepllaqqhieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavh
ktqdvrngqvvvariddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavg
virng

Sequence, based on observed residues (ATOM records): (download)

>d1jhfb_ b.87.1.1 (B:) LexA C-terminal domain {Escherichia coli [TaxId: 562]}
glplvieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavhktqdvrngqvvvar
iddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavgvirng

SCOPe Domain Coordinates for d1jhfb_:

Click to download the PDB-style file with coordinates for d1jhfb_.
(The format of our PDB-style files is described here.)

Timeline for d1jhfb_: