Class b: All beta proteins [48724] (177 folds) |
Fold b.87: LexA/Signal peptidase [51305] (1 superfamily) complex fold made of several coiled beta-sheets; contains an SH3-like barrel |
Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) |
Family b.87.1.1: LexA-related [51307] (4 proteins) |
Protein LexA C-terminal domain [63871] (1 species) |
Species Escherichia coli [TaxId:562] [63872] (4 PDB entries) |
Domain d1jhca_: 1jhc A: [63054] |
PDB Entry: 1jhc (more details), 2 Å
SCOPe Domain Sequences for d1jhca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhca_ b.87.1.1 (A:) LexA C-terminal domain {Escherichia coli [TaxId: 562]} glplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmamkdigimdgdllavh ktqdvrngqvvvariddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavg virngdwlvp
Timeline for d1jhca_: