Lineage for d1jhca_ (1jhc A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083983Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 2083984Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 2083985Family b.87.1.1: LexA-related [51307] (4 proteins)
  6. 2083998Protein LexA C-terminal domain [63871] (1 species)
  7. 2083999Species Escherichia coli [TaxId:562] [63872] (4 PDB entries)
  8. 2084002Domain d1jhca_: 1jhc A: [63054]

Details for d1jhca_

PDB Entry: 1jhc (more details), 2 Å

PDB Description: lexa s119a c-terminal tryptic fragment
PDB Compounds: (A:) lexa repressor

SCOPe Domain Sequences for d1jhca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhca_ b.87.1.1 (A:) LexA C-terminal domain {Escherichia coli [TaxId: 562]}
glplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmamkdigimdgdllavh
ktqdvrngqvvvariddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavg
virngdwlvp

SCOPe Domain Coordinates for d1jhca_:

Click to download the PDB-style file with coordinates for d1jhca_.
(The format of our PDB-style files is described here.)

Timeline for d1jhca_: