Lineage for d1jhaa_ (1jha A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1366654Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 1366655Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 1366656Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
    automatically mapped to Pfam PF02277
  6. 1366657Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)
  7. 1366658Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)
  8. 1366676Domain d1jhaa_: 1jha A: [63053]
    complexed with aam, nio

Details for d1jhaa_

PDB Entry: 1jha (more details), 2 Å

PDB Description: Structural Investigation of the Biosynthesis of Alternative Lower Ligands for Cobamides by Nicotinate Mononucleotide:5,6-Dimethylbenzimidazole Phosphoribosyltransferase (CobT) from Salmonella enterica
PDB Compounds: (A:) nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1jhaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhaa_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
gvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttpa
aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

SCOPe Domain Coordinates for d1jhaa_:

Click to download the PDB-style file with coordinates for d1jhaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jhaa_: